Protein coding transcript 154340

• Transcript: Ll_transcript_208695
• CDS coordinates: 13-471 (+)
• Peptide sequence: MQLHFSASMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFLFILTALVTLEGVNNCSSFDCFGRRLGPRLLGRVDDSGRLARDLYKILNEVNTAEIPADLKLPDSFNHLVSDMKSNQYNARTFAFMLRGMMEKFEKEIRDSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_208695

• Blastp: Probable galacturonosyltransferase 14 from Arabidopsis with 79.74% of identity
• Blastx: Probable galacturonosyltransferase 14 from Arabidopsis with 79.74% of identity
• Eggnog: Galacturonosyltransferase(ENOG410ZY1J)
• Kegg: Link to kegg annotations (AT5G15470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428620.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;