Protein coding transcript 154341

• Transcript: Ll_transcript_208696
• CDS coordinates: 512-889 (+)
• Peptide sequence: MQLQLSGSMRSITISSNNGFIELMKIKVAACHISYRTLFHTILFLAFLLPFLFILTALVTLEGVNKCSSFDCFGRRLGPRLLGRVDDSGRLVRDFYKILNDVNTGEIPADLKLPNSFDQLVSDMKN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_208696

• Blastp: Probable galacturonosyltransferase 13 from Arabidopsis with 84.25% of identity
• Blastx: Probable galacturonosyltransferase 14 from Arabidopsis with 83.33% of identity
• Eggnog: Galacturonosyltransferase(ENOG410ZY1J)
• Kegg: Link to kegg annotations (AT3G01040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452957.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;