Protein coding transcript 154343

• Transcript: Ll_transcript_208703
• CDS coordinates: 13-354 (+)
• Peptide sequence: MQLHFSASMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVTLEGVNKCSSFDCFGRRLGPRLLGRVDDSGRLVRDFYKILNEVNIGEIPADLKLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_208703

• Blastp: Probable galacturonosyltransferase 13 from Arabidopsis with 87.83% of identity
• Blastx: Probable galacturonosyltransferase 13 from Arabidopsis with 87.83% of identity
• Eggnog: Galacturonosyltransferase(ENOG410ZY1J)
• Kegg: Link to kegg annotations (AT3G01040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452957.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;