| Transcript | Ll_transcript_208924 |
|---|---|
| CDS coordinates | 178-489 (+) |
| Peptide sequence | MPSSSFSLFPFAVTFPLFFAFIALAADPSSCNNPIQMVKVQNWIDGKEGDLYNGMTAKFGTSLPEKADKTLRAPAVPSKPLDCCAASTTKVPFSHFSLSLQFD* |
| ORF Type | complete |
| Blastp | Signal peptide peptidase-like 3 from Arabidopsis with 45.83% of identity |
|---|---|
| Blastx | Signal peptide peptidase-like 3 from Arabidopsis with 45.83% of identity |
| Eggnog | signal peptide(ENOG410ZP52) |
| Kegg | Link to kegg annotations (AT2G43070) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441583.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer