Protein coding transcript 154570

• Transcript: Ll_transcript_209136
• CDS coordinates: 1-330 (+)
• Peptide sequence: RTKRKSMLSALEKVKEEKNSGTVEHIFWPSSEYSNRTILQENVNNGLHNYCPKGKESFASYESLEQLHSLLFILGVTHVFYSFIAVGLAMIKVKIGMIKLSSYSNFGDTN
• ORF Type: internal

Annotations of Ll_transcript_209136

• Blastp: MLO-like protein 11 from Arabidopsis with 34.07% of identity
• Blastx: MLO-like protein 11 from Arabidopsis with 34.07% of identity
• Eggnog: May be involved in modulation of pathogen defense and leaf cell death (By similarity)(ENOG410XR5S)
• Kegg: Link to kegg annotations (AT5G53760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444838.1)
• Pfam: Mlo family (PF03094.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;