Protein coding transcript 1546

• Transcript: Ll_transcript_534136
• CDS coordinates: 2-607 (+)
• Peptide sequence: DDGRITDGQGRVIDAKNCIVVMTSNLGADHLARPVGTDGKIDPTTRELVMTSLRNYFLPEFLNRISSIVIFNRLTKKEIRKIVDVRLDEIQARLKGNNRDVKIDLSPEVKDYLGAAGYSPAYGARPLARLIEKEVLNRLAVLILRGSIRDGEVARVELEDGHIVVIPNHGDSDGDDDDIDMSDEEALLELEDRDGDMELYD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_534136

• Blastp: Heat shock protein hsp98 from Neurospora with 70.3% of identity
• Blastx: Heat shock protein hsp98 from Neurospora with 78.7% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU00104)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013460069.1)
• Pfam: AAA domain (Cdc48 subfamily) (PF07724.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;