Transcript | Ll_transcript_208943 |
---|---|
CDS coordinates | 185-817 (+) |
Peptide sequence | MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQTAKSSDKQNDMNKTPSRVSSMFSGTLDKCSVCSKTVYPLEKVTLEGECYHKTCFRCAHAGCPLTHSSYAALDGVLYCRHHFAQLFMEKGNYNHVLQAAQAHKRNNSTPPPEPVDDESSKQPEEPEEKKEEEDS* |
ORF Type | complete |
Blastp | LIM domain-containing protein PLIM2c from Arabidopsis with 70.67% of identity |
---|---|
Blastx | LIM domain-containing protein PLIM2c from Arabidopsis with 74.35% of identity |
Eggnog | LIM domain-containing protein(ENOG410YCS6) |
Kegg | Link to kegg annotations (AT3G61230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460659.1) |
Pfam | LIM domain (PF00412.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer