Protein coding transcript 154672

• Transcript: Ll_transcript_208950
• CDS coordinates: 185-508 (+)
• Peptide sequence: MSFTGTLDKCKACDKTVYVVDLLTLEGIPYHKNCFKCSHCKGYLTMSTYSSMDGVLYCKPHFEQLFKESGNFSKNFQTAKSSDKQNDMVSSLSYLSICDTHFSALQT*
• ORF Type: complete

Annotations of Ll_transcript_208950

• Blastp: LIM domain-containing protein PLIM2c from Arabidopsis with 72.63% of identity
• Blastx: LIM domain-containing protein PLIM2c from Arabidopsis with 72.63% of identity
• Eggnog: LIM domain-containing protein(ENOG410YCS6)
• Kegg: Link to kegg annotations (AT3G61230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460659.1)
• Pfam: LIM domain (PF00412.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;