Protein coding transcript 154673

• Transcript: Ll_transcript_208951
• CDS coordinates: 436-864 (+)
• Peptide sequence: MIFFMNINDVPAKSSDKQNDMNKAPSRVSSMFSGTLDKCSVCTKTVYPLEKVSLEGECYHKTCFRCAHAGCPLTHSSYAALDGVLYCRHHFAQLFMEKGNYNHVLQAAQAHKKNSTPPPEPVDDESSKLPEESVEEQKDENP*
• ORF Type: complete

Annotations of Ll_transcript_208951

• Blastp: LIM domain-containing protein PLIM2c from Arabidopsis with 61.03% of identity
• Blastx: LIM domain-containing protein PLIM2c from Arabidopsis with 61.48% of identity
• Eggnog: LIM domain-containing protein(ENOG410YCS6)
• Kegg: Link to kegg annotations (AT3G61230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434506.1)
• Pfam: LIM domain (PF00412.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;