Protein coding transcript 154718

• Transcript: Ll_transcript_207584
• CDS coordinates: 343-771 (+)
• Peptide sequence: MKFCKTYQEYMQGQQHDLPGLGFKNLKKIMKTCRRDFHSHNSLNPINSCHHQCPVCDGTFFPSLLNEMSDVLGCFNHRAQKLLDLHLASGFRKYLFWLKAKLQGDHTVLVQEGRDLVTYALINAIAIRKILKKYDKVCLSILV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_207584

• Blastp: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 63.19% of identity
• Blastx: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 62.32% of identity
• Eggnog: E3 ubiquitin-protein ligase BAH1-like(ENOG4110S99)
• Kegg: Link to kegg annotations (AT1G02860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452639.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;