Protein coding transcript 154719

• Transcript: Ll_transcript_207586
• CDS coordinates: 225-794 (+)
• Peptide sequence: MSDVLGCFNHRAQKLLDLHLASGFRKYLFWLKAKLQGDHTVLVQEGRDLVTYALINAIAIRKILKKYDKIHYSKQGQLFKSQVQTMHKEILQSPWLIELMALYLNLRRTKSESMKAPALFDGCSLTFKDGKPSLTCELFDSIKIDIDLTCSVCLVSSVASLAFISYYHSVHYSHFRFLNNKTKPCEHVA*
• ORF Type: complete

Annotations of Ll_transcript_207586

• Blastp: Probable E3 ubiquitin-protein ligase BAH1-like 2 from Oryza sativa with 64.29% of identity
• Blastx: Probable E3 ubiquitin-protein ligase BAH1-like 1 from Oryza sativa with 66.26% of identity
• Eggnog: E3 ubiquitin-protein ligase BAH1-like(ENOG4110S99)
• Kegg: Link to kegg annotations (4344254)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452639.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;