Protein coding transcript 154721

• Transcript: Ll_transcript_207589
• CDS coordinates: 343-1113 (+)
• Peptide sequence: MKFCKTYQEYMQGQQHDLPGLGFKNLKKIMKTCRRDFHSHNSLNPINSCHHQCPVCDGTFFPSLLNEMSDVLGCFNHRAQKLLDLHLASGFRKYLFWLKAKLQGDHTVLVQEGRDLVTYALINAIAIRKILKKYDKIHYSKQGQLFKSQVQTMHKEILQSPWLIELMALYLNLRRTKSESMKAPALFDGCSLTFKDGKPSLTCELFDSIKIDIDLTCSVCLVSSVASLAFISYYHSVHYSHFRFLNNKTKPCEHVA*
• ORF Type: complete

Annotations of Ll_transcript_207589

• Blastp: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 63.56% of identity
• Blastx: E3 ubiquitin-protein ligase BAH1 from Arabidopsis with 62.67% of identity
• Eggnog: E3 ubiquitin-protein ligase BAH1-like(ENOG4110S99)
• Kegg: Link to kegg annotations (AT1G02860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452639.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;