Transcript | Ll_transcript_207425 |
---|---|
CDS coordinates | 1410-2558 (+) |
Peptide sequence | MIATNAAIPGVFQNMFPLATSQVQPFSALPVMPVQAMTQQATRHARRVYVGGLSPTANEQSVATFFSQVMANIGGNTAGPGDAVVNVYINHDKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPTDYNPSLAATLGPSQPNPNLNLGAVGLTPGSAGGLDGPDRIFVGGLPYYFTETQIRELLETFGPLRGFDLVKDRETGNSKGYAFCVYQDLAVTDIACAALNGIKMGDKTLTVRRANQGSNLVQPKPEQESILMHAQQQIALQKLMLQPALVATKVVCLTHAVAADELKDDEDYEEILDDMRQECSKFGTLVNVVIPRPRPDGELAPGVGKVFLEYVDVDGATKARVGLNGRKFGGNQVIAVFYPENKFAQGDYEG* |
ORF Type | complete |
Blastp | Splicing factor U2af large subunit B from Nicotiana with 83.11% of identity |
---|---|
Blastx | Splicing factor U2af large subunit B from Nicotiana with 82.6% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000929) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440705.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer