Transcript | Ll_transcript_208234 |
---|---|
CDS coordinates | 3-707 (+) |
Peptide sequence | TLLPPKSKMGKKNKRREIDAESEAEFVATNDHSGDSQNANKKEKKKKQKNKNQNEIPTVSIAVAASIIDNVPTLELATRLAGQIARAATIFRINEVVVFDNKSIPGQDSTVNNSDDESSAAFFIRVLQYLETPQYLRKALFPMHNNLRFVGLLPPLDAPHHLRKHEWGSYREGVTLRERDSNSGATLVDVGLAKHVLVDQILEPGRRVTVAMGTNRNLDSGNELNFAILFVQSC* |
ORF Type | 5prime_partial |
Blastp | Putative methyltransferase C9orf114 homolog from Mus with 47.31% of identity |
---|---|
Blastx | Putative methyltransferase C9orf114 homolog from Mus with 47.83% of identity |
Eggnog | chromosome 9 open reading frame 114(COG2106) |
Kegg | Link to kegg annotations (227695) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428093.1) |
Pfam | Putative RNA methyltransferase (PF02598.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer