Protein coding transcript 154878

• Transcript: Ll_transcript_208218
• CDS coordinates: 3-530 (+)
• Peptide sequence: TLLPPKSKMGKKNKRREIDAESEAEFVATNDHSGDSQNANKKEKKKKQKNKNQNEIPTVSIAVAASIIDNVPTLELATRLAGQIARAATIFRINEVVVFDNKSIPGQDSTVNNSDDESSAAFFIRVLQYLETPQYLRKALFPMHNNLRFVGLLPPLDAPHHLRKHEWGSYREGGP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_208218

• Blastp: Putative methyltransferase C9orf114 homolog from Mus with 49.61% of identity
• Blastx: Putative methyltransferase C9orf114 homolog from Mus with 50.41% of identity
• Eggnog: chromosome 9 open reading frame 114(COG2106)
• Kegg: Link to kegg annotations (227695)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428093.1)
• Pfam: Putative RNA methyltransferase (PF02598.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;