Protein coding transcript 1549

• Transcript: Ll_transcript_534108
• CDS coordinates: 1223-1747 (+)
• Peptide sequence: MSNPKVYFDILIGKLKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYKGSAFHRIIPDFMCQGGDFTRGNGTGGESIYGAKFVDENFKLKHTGPGILSMANAGPNTNGSQFFICTSKTSWLDGKHVVFGKVVDGYSVVQEMEKVGSNGGSTSEPVVIEDCGQIKEN*
• ORF Type: complete

Annotations of Ll_transcript_534108

• Blastp: Peptidyl-prolyl cis-trans isomerase CYP19-3 from Arabidopsis with 85.47% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP19-3 from Arabidopsis with 85.47% of identity
• Eggnog: peptidyl-prolyl cis-trans isomerase activity(COG0652)
• Kegg: Link to kegg annotations (AT3G56070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433438.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;