Transcript | Ll_transcript_207953 |
---|---|
CDS coordinates | 2058-2810 (+) |
Peptide sequence | MAVPDPTQPHGLKLVMEDYPYASDGLLIWSAIENWVRKYVNHYYPNSSKISNDKELQAWYTESINVGHADLRNESWWPTLNTSEDLISILSILIWNASAQHAALNFGQYPYGGFVPNRPPLMRRLIPEETDPEYASFLADPQKYFLNALPSVLQASKYMAVVDTLSTHSSDEEYLGERQQPSIWSGDAEIIEAFYDFSAEIGRIEKVIDSRNCNRTLRNRCGAGVLPYELLAPSSEPGVTCRGVPNSVSI* |
ORF Type | complete |
Blastp | Linoleate 13S-lipoxygenase 3-1, chloroplastic from Solanum with 81.6% of identity |
---|---|
Blastx | Linoleate 13S-lipoxygenase 3-1, chloroplastic from Solanum with 81.75% of identity |
Eggnog | Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N) |
Kegg | Link to kegg annotations (102597498) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425679.1) |
Pfam | Lipoxygenase (PF00305.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer