Protein coding transcript 154971

• Transcript: Ll_transcript_207380
• CDS coordinates: 2-484 (+)
• Peptide sequence: DVRYIRVSAPVRSAMTEFTGNGGAELVVSPASLTVSGSFKECRGLSTRRRGSTRPPSMDADEFMNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEELTEILSKVEGKLKLTESLLESKNLEIKKINDEKKASMAAQFAAEATL
• ORF Type: internal

Annotations of Ll_transcript_207380

• Blastp: Microtubule-associated protein 70-1 from Arabidopsis with 68.75% of identity
• Blastx: Microtubule-associated protein 70-1 from Arabidopsis with 66.24% of identity
• Eggnog: Microtubule-associated protein(ENOG410ZDCM)
• Kegg: Link to kegg annotations (AT1G68060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461517.1)
• Pfam: Microtubule-associated protein 70 (PF07058.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;