Transcript | Ll_transcript_207381 |
---|---|
CDS coordinates | 320-661 (+) |
Peptide sequence | MTEFTGNGGAELVVSPASLTVSGSFKECRGLSTRRRGSTRPPSMDADEFMNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRLSERLREKAVEEVNLISFFVFYLFI* |
ORF Type | complete |
Blastp | Microtubule-associated protein 70-4 from Arabidopsis with 73.63% of identity |
---|---|
Blastx | Microtubule-associated protein 70-4 from Arabidopsis with 72.22% of identity |
Eggnog | microtubule-associated proteins 70-4(ENOG41104MM) |
Kegg | Link to kegg annotations (AT1G14840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461517.1) |
Pfam | Microtubule-associated protein 70 (PF07058.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer