Protein coding transcript 154974

• Transcript: Ll_transcript_207383
• CDS coordinates: 320-754 (+)
• Peptide sequence: MTEFTGNGGAELVVSPASLTVSGSFKECRGLSTRRRGSTRPPSMDADEFMNLLHGSDPVKVELNRLENEVRDKDRELSEAQAEIKALRFSERLREKAVEEVNLISQFFWVSLKMGRKKSIRCRSFAYSQVHYLPLIIFIFLQIK*
• ORF Type: complete

Annotations of Ll_transcript_207383

• Blastp: Microtubule-associated protein 70-4 from Arabidopsis with 72.53% of identity
• Blastx: Microtubule-associated protein 70-4 from Arabidopsis with 71.11% of identity
• Eggnog: microtubule-associated proteins 70-4(ENOG41104MM)
• Kegg: Link to kegg annotations (AT1G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461517.1)
• Pfam: Microtubule-associated protein 70 (PF07058.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;