Protein coding transcript 154981

• Transcript: Ll_transcript_207704
• CDS coordinates: 52-612 (+)
• Peptide sequence: MMNGVVVFLMVVVVANAQTSFQGRCPDVQTKRNFNLKKFSGKWFEAGRYFGGIEKGGKCVTAEYNVKRNGRVTLRYKLIDSIYSPSIEAFGKVISKNDPAKLSFHFPSIDVDSPYWILATDYKNYAVVWSCAEFESYDYSIRGAWILTRSKNPTSRIIQKAYSALDKNGISQIYLVQTNQTNCPLN*
• ORF Type: complete

Annotations of Ll_transcript_207704

• Blastp: Apolipoprotein D from Mus with 31.22% of identity
• Blastx: Apolipoprotein D from Mus with 33.92% of identity
• Eggnog: Outer membrane lipoprotein(COG3040)
• Kegg: Link to kegg annotations (11815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016200058.1)
• Pfam: Triabin (PF03973.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;