Transcript | Ll_transcript_228039 |
---|---|
CDS coordinates | 2-448 (+) |
Peptide sequence | GHEITGEIVEHGPLSDPKTVERLPLGSRVVGAFIMPCGNCSYCSKGHDDLCEPFFAYNRAKGTLYDGETRLFLRSNGKPVFMYSMGGLAEYCVVPANAVSVLPKSLPYNESAILGCAVFTAYGAMAHAAQVRPGDSVAVIGTGGVGSR* |
ORF Type | 5prime_partial |
Blastp | Succinate-semialdehyde dehydrogenase (acetylating) from Metallosphaera with 41.18% of identity |
---|---|
Blastx | Succinate-semialdehyde dehydrogenase (acetylating) from Metallosphaera with 39.39% of identity |
Eggnog | alcohol dehydrogenase(COG1062) |
Kegg | Link to kegg annotations (Msed_1424) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432415.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer