| Transcript | Ll_transcript_229157 |
|---|---|
| CDS coordinates | 85-591 (+) |
| Peptide sequence | MFHIGGDSMLIFQIKDSIQPAYCHVIEEESDGKPWYHDIREYLRGQTYPLNATENDKRTLRRLAANFFLSGEVVYKRSHYLVLLRCLEAKEAQKMMEEVHEGTFGTHTNGHAMAKKIMRAGYFWLTMEGDCCKHVKKCHKCQIYADNINAPPNPLNVLTSPWPFSMWGM |
| ORF Type | 3prime_partial |
| Blastp | Gypsy retrotransposon integrase-like protein 1 from Rattus with 24.62% of identity |
|---|---|
| Blastx | - |
| Eggnog | Retrotransposon protein(COG2801) |
| Kegg | Link to kegg annotations (316687) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431094.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer