Protein coding transcript 155078

• Transcript: Ll_transcript_227999
• CDS coordinates: 3-773 (+)
• Peptide sequence: VAGSSNSIRSETPTPSLVTPGQLLQPGPTVVSTAHPSQTPHKDVEVVQVSSTSSPQSSLPVSAENQPPILPLPVTSRSSHRPGGAPIQSHHGYGYRGRGRGRGNGVLRPVTKFTEEFDFMAMNEKFKKDEVWGDLGKSNKSHLKEKDGEENSLDEDYIQDGDNDDSSNFKPVYNKDDFFDSLSSSALDQASHNGRIRYSEQIKIDTETFGNFVRPRGGRGGRGPFRGGHLSRGGYYGRGYGYSGRGRGRGMPSHNS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_227999

• Blastp: Protein decapping 5 from Arabidopsis with 56.07% of identity
• Blastx: Protein decapping 5 from Arabidopsis with 56.13% of identity
• Eggnog: LSM14A, SCD6 homolog A (S. cerevisiae)(ENOG41122RA)
• Kegg: Link to kegg annotations (AT1G26110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455652.1)
• Pfam: FDF domain (PF09532.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;