Protein coding transcript 155116

• Transcript: Ll_transcript_227886
• CDS coordinates: 330-800 (+)
• Peptide sequence: MATKHEEELAKRVQYPLDPSSYKILDEIGAGVSAIVYKATCVPMNSLVAIKSIDLDRSRPDFDDVRREAKTLSLLYHHNILNAHCCFTVDQRLWVVMPFMAGGSLQSIISHSFSDGLTEPCIAVVLKETLNALSYLHGQGHLHRDIKAGNVRNSAW*
• ORF Type: complete

Annotations of Ll_transcript_227886

• Blastp: Serine/threonine-protein kinase BLUS1 from Arabidopsis with 68.79% of identity
• Blastx: Serine/threonine-protein kinase BLUS1 from Arabidopsis with 68.79% of identity
• Eggnog: ste20-related kinase adaptor(ENOG410XSWS)
• Kegg: Link to kegg annotations (AT4G14480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448227.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;