Protein coding transcript 155179

• Transcript: Ll_transcript_228401
• CDS coordinates: 65-583 (+)
• Peptide sequence: MAAFVNHLRNLNSIQRILLQSSSNSTHRCFSKLPHHHHHPHATPKSSLKDNELAKFAAISETWWDSEGPFKPLHIMNPTRLAFIRSTLCRHFKRDPNSVRPLEGLKIVDVGCGGGILSEPLARMGATVTGVDAVEKNIKIAQLHADLDPATSNIEFCCTTAGTYANLNSFSV*
• ORF Type: complete

Annotations of Ll_transcript_228401

• Blastp: Ubiquinone biosynthesis O-methyltransferase, mitochondrial from Arabidopsis with 74.79% of identity
• Blastx: Ubiquinone biosynthesis O-methyltransferase, mitochondrial from Arabidopsis with 74.79% of identity
• Eggnog: Non-specific O-methyltransferase that catalyzes the 2 O- methylation steps in the ubiquinone biosynthetic pathway (By similarity)(COG2227)
• Kegg: Link to kegg annotations (AT2G30920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459345.1)
• Pfam: Methyltransferase domain (PF13847.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;