Protein coding transcript 155188

• Transcript: Ll_transcript_229494
• CDS coordinates: 53-952 (+)
• Peptide sequence: MRSYIGTPPTEPTTSFLFSNRKSHLKSEMATIATIKARQIFDSRGNPTVEVDLTLSDGTFARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVDNVNTIIAPALIGKDPTEQTAIDNFIVQELDGTVNEWGWGKQKLGANAILAVSLAVCKAGASALKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASTFKEALKIGVEVYHNLKSVIKKKYGQDAVNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYTSDKKYDLNFKEDNN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_229494

• Blastp: Enolase from Ricinus with 88.89% of identity
• Blastx: Enolase from Ricinus with 88.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8288376)
• CantataDB: Link to cantataDB annotations (CNT0002948)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426170.1)
• Pfam: Enolase, N-terminal domain (PF03952.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;