| Transcript | Ll_transcript_229324 |
|---|---|
| CDS coordinates | 174-521 (+) |
| Peptide sequence | MFYAIRCIYEGYQTLSQDVEEGICQVLAHMWLESELSSASGSNLLSASSSSASYASRKGKSPAFERKLGEFFMHQIESDISPVYGDGFRAGQIAVRKYGLQKTLNHIWMTGTFPF* |
| ORF Type | complete |
| Blastp | Protein DA1 from Arabidopsis with 67.62% of identity |
|---|---|
| Blastx | Protein DA1 from Arabidopsis with 64.76% of identity |
| Eggnog | PDZ and LIM domain(ENOG410XRD4) |
| Kegg | Link to kegg annotations (AT1G19270) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458702.1) |
| Pfam | Protein DA1 (PF12315.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer