Protein coding transcript 155309

• Transcript: Ll_transcript_229313
• CDS coordinates: 3684-4229 (+)
• Peptide sequence: MPETRGLCLSEEQTISSISRRPRLGTGNRAIDMRTQPYKLTRRCDVTAILILFGLPRLLTGSILAHEMMHAWLRLRGYQTLSQDVEEGICQVLAHMWLESELSSASGSNLLSASSSSASYASRKGKSPAFERKLGEFFMHQIESDISPVYGDGFRAGQIAVRKYGLQKTLNHIWMTGTFPF*
• ORF Type: complete

Annotations of Ll_transcript_229313

• Blastp: Protein DA1 from Arabidopsis with 71.11% of identity
• Blastx: Protein DA1 from Arabidopsis with 69.73% of identity
• Eggnog: PDZ and LIM domain(ENOG410XRD4)
• Kegg: Link to kegg annotations (AT1G19270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458702.1)
• Pfam: Protein DA1 (PF12315.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;