Protein coding transcript 155342

• Transcript: Ll_transcript_228209
• CDS coordinates: 461-898 (+)
• Peptide sequence: MIGLSCFIYKKFKIHHGPNTELPSNISVFNLQLQPGNLTAGLDGPEIEKFPKTLIGESGRLPKPNNNICPICLCDYEPKEMLRTIPECNHYFHASCIDEWLKMNATCPLCRNSPDAASSNVASSSSSSSSRTIDNPSPNHTFHTT*
• ORF Type: complete

Annotations of Ll_transcript_228209

• Blastp: Putative RING-H2 finger protein ATL69 from Arabidopsis with 57.47% of identity
• Blastx: Putative RING-H2 finger protein ATL69 from Arabidopsis with 47.69% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G07040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446495.1)
• Pfam: Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;