Protein coding transcript 155349

• Transcript: Ll_transcript_228219
• CDS coordinates: 3-863 (+)
• Peptide sequence: EPYNISTILPPSKPIFLCFRREIEMLMSQIGFGVKFGNWRCYASSSSSSSSSSQSEVAVVEGGNGRISERQHIRLGLPSKGRMATDTTDLLKNCQLSVKQVNPRQYVAQIPELSNFEVWFQRPKDIVKKLGSGDLDLGIVGLDTFTEHGQGNEDLIIVHEALAYGDCRLSLAIPQYGIFENINSLEELAKMPQWTESKPLRVATGFTYLGPKFMKDNGLKHVTFSTADGALEAAPAVRDNFFLLGLVHLSFLFDSFLNYIIDPYHRDSTKFYVSCLMRHSHFILSF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_228219

• Blastp: ATP phosphoribosyltransferase 2, chloroplastic from Arabidopsis with 72.38% of identity
• Blastx: ATP phosphoribosyltransferase 2, chloroplastic from Arabidopsis with 76.56% of identity
• Eggnog: Catalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate of histidine biosynthesis seems to be controlled primarily by regulation of HisG enzymatic activity (By similarity)(COG0040)
• Kegg: Link to kegg annotations (AT1G09795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443309.1)
• Pfam: ATP phosphoribosyltransferase (PF01634.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;