Protein coding transcript 155397

• Transcript: Ll_transcript_228901
• CDS coordinates: 352-963 (+)
• Peptide sequence: MLVSMQDCLLRNSSNSVRAIQEEPKGSYNPSRVLEKGHTKQRPRVHQQLLLLPLLKRDYMLFIWVTFDSLWLEMMDAPFSGPPIQQHGFNFTYQLESGNGGDLPSSGEALGQNLGQQIVVPLKVTLLDLLLEDLDPYLLKLRHCLPFPTHKIYLSCQTNAPIKPKEIIFSSLLKHRHSIYYISWVLKVKRTAQLFLLVQRSHS*
• ORF Type: complete

Annotations of Ll_transcript_228901

• Blastp: Probable protein phosphatase 2C 55 from Arabidopsis with 46.88% of identity
• Blastx: Probable protein phosphatase 2C 55 from Arabidopsis with 45.92% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G16580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421443.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;