Protein coding transcript 155398

• Transcript: Ll_transcript_228902
• CDS coordinates: 861-1208 (-)
• Peptide sequence: MEPHKAFLASSFWLFLVTFLTISLHGVVGISEEEHVAPHVGPVVKRDQRRTLYDTEYGEISSIDIKGGHSAPPYHLQFFTLEPNSVFLPVLLHVNMVFYVHTGNLYISIFYLHHF*
• ORF Type: complete

Annotations of Ll_transcript_228902

• Blastp: Vicilin-like seed storage protein At4g36700 from Arabidopsis with 41.27% of identity
• Blastx: Vicilin-like seed storage protein At4g36700 from Arabidopsis with 32.12% of identity
• Eggnog: Cupin family(ENOG410YF6C)
• Kegg: Link to kegg annotations (AT4G36700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444752.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;