Protein coding transcript 155410

• Transcript: Ll_transcript_227822
• CDS coordinates: 152-1336 (+)
• Peptide sequence: MVADEVPVDDKAKRMRDLLSSFYSPDPSISSNSITNPSKHDDINSDSFDPDHYMNILAHKSNLEGLLQRHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKRMKSNISGMETNMEQLLEKIVSVQSRSDSVNTSLFDKREHIEKLHRTCNLLRKVQFIYDLPDRLGKCIKSEAYADAVRFYTGAMPIFKAYGNSSFQDCKRASEEAIATIIKNLQGKLFSDSESIQARAEAAVLLKRLDFPVDNLKARLLEKLEQSLTDIKLKPAEINNPSVDLSPSVSAHKAAVHEFTEAVRAFRAIFPDSKGQLVKLAHDLITNNFVIAEEYVKTRICADDLLGVLRVIWDDVLLIDEVLQEAALSSNSFEVIHQTFKLKFETDLSSSFSLFCSSFSVFV*
• ORF Type: complete

Annotations of Ll_transcript_227822

• Blastp: Vacuolar protein sorting-associated protein 51 homolog from Arabidopsis with 67.54% of identity
• Blastx: Vacuolar protein sorting-associated protein 51 homolog from Arabidopsis with 67.54% of identity
• Eggnog: vacuolar protein sorting 51 homolog (S. cerevisiae)(ENOG410XPIF)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441303.1)
• Pfam: COG (conserved oligomeric Golgi) complex component, COG2 (PF06148.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;