Transcript | Ll_transcript_227810 |
---|---|
CDS coordinates | 152-1192 (+) |
Peptide sequence | MVADEVPVDDKAKRMRDLLSSFYSPDPSISSNSITNPSKHDDINSDSFDPDHYMNILAHKSNLEGLLQRHVEMAAEIKNLDTDLQMLVYENYNKFISATDTIKRMKSNISGMETNMEQLLEKIVSVQSRSDSVNTSLFDKREHIEKLHRTCNLLRKVQFIYDLPDRLGKCIKSEAYADAVRFYTGAMPIFKAYGNSSFQDCKRASEEAIATIIKNLQGKLFSDSESIQARAEAAVLLKRLDFPVDNLKARLLEKLEQSLTDIKLKPAEINNPSVDLSPSVSAHKAAVHEFTEAVRAFRAIFPDSKGQLVKLAHDLITKFVSLSTLSHFICCTYTCDINFLMFLVTS* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 51 homolog from Arabidopsis with 71.08% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 51 homolog from Arabidopsis with 64.29% of identity |
Eggnog | vacuolar protein sorting 51 homolog (S. cerevisiae)(ENOG410XPIF) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441303.1) |
Pfam | COG (conserved oligomeric Golgi) complex component, COG2 (PF06148.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer