Protein coding transcript 1555

• Transcript: Ll_transcript_452789
• CDS coordinates: 112-606 (+)
• Peptide sequence: MAKKLSKVAFDAKLGKLLKEYSRVLVISSDNIGCNELQGIRRNLHADSVVVMGKNSMMKRSLMLDAQRTGNKAFLNLAPLLHVVDPILMCPKFMSYDSYQNCSYMQSGQLPLNLTCCKQQSSQTSEPFLVSSKFSPHQHCFMSRSRQFLMTSVWAPLLLLAGNL*
• ORF Type: complete

Annotations of Ll_transcript_452789

• Blastp: 60S acidic ribosomal protein P0 from Soja with 58.23% of identity
• Blastx: 60S acidic ribosomal protein P0 from Soja with 58.23% of identity
• Eggnog: 50s ribosomal protein L10(COG0244)
• Kegg: Link to kegg annotations (547816)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453731.1)
• Pfam: Ribosomal protein L10 (PF00466.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;