Protein coding transcript 155510

• Transcript: Ll_transcript_228202
• CDS coordinates: 1028-1549 (+)
• Peptide sequence: MICVTTLMCVSQHIFKFVYTSFCLLNLEVVNLFCQYRNYNYGAVGEALKIDLLSHPEYIEQNATLAFQAAIWRWMTPIKKSQPSAHQAFVGNWKPNKNDTLENRVPGFGITMNILYGEGVCGQGDVDQMNNIISHYLYYLDLLGVGREQAGAHEVVSCAEQKAFNPITKASSS*
• ORF Type: complete

Annotations of Ll_transcript_228202

• Blastp: Chitinase-like protein 1 from Arabidopsis with 75.94% of identity
• Blastx: Chitinase-like protein 2 from Arabidopsis with 75.32% of identity
• Eggnog: chitinase(COG3979)
• Kegg: Link to kegg annotations (AT1G05850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419595.1)
• Pfam: Chitinase class I (PF00182.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;