Transcript | Ll_transcript_228455 |
---|---|
CDS coordinates | 1-342 (+) |
Peptide sequence | NRLSQLEDPSEVHLVIALGNGLVYISFFVLLQYVKGLMFFWIMIRGPPRFEGERRFGGDRDGYRGGPRAPGGEFGGEKSGAPADYRPSFGGPGGRSGFGRGAGGYGAPSNTNA* |
ORF Type | 5prime_partial |
Blastp | 40S ribosomal protein S10-2 from Oryza sativa with 70% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (4329619) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003593023.2) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer