Protein coding transcript 155580

• Transcript: Ll_transcript_228444
• CDS coordinates: 3-359 (+)
• Peptide sequence: HYYWFLTNDGIEFLRTYLNLPSEIVPATLKKQAKPIGRPFGGPPGDRPRGPPRFDGERRFGGDRDGYRGGPRGPGGDFGGDKGGAPADYRPSFGGPPGGRSGFGRGAGGYGAPPSSNA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_228444

• Blastp: 40S ribosomal protein S10-1 from Arabidopsis with 78.49% of identity
• Blastx: 40S ribosomal protein S10-2 from Arabidopsis with 88.89% of identity
• Eggnog: Ribosomal protein(COG5045)
• Kegg: Link to kegg annotations (AT4G25740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429890.1)
• Pfam: Plectin/S10 domain (PF03501.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;