Protein coding transcript 155583

• Transcript: Ll_transcript_228448
• CDS coordinates: 73-615 (+)
• Peptide sequence: MIISEKNRKEISKYLFQEGVLYAKKDFNLAKHPEIDVPNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNDGIEFLRTYLNLPSEIVPATLKKQAKPAGRPFGGPPGDRPRGPPRFDGERRFGGDRDGYRGGPRAPTGDFGGEKGGAPADYRPSFGGPPGGRSGFGRGAGGYGAPPPSNA*
• ORF Type: complete

Annotations of Ll_transcript_228448

• Blastp: 40S ribosomal protein S10-2 from Oryza sativa with 82.05% of identity
• Blastx: 40S ribosomal protein S10-3 from Arabidopsis with 89.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (4329619)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421657.1)
• Pfam: Plectin/S10 domain (PF03501.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;