Protein coding transcript 1556

• Transcript: Ll_transcript_452822
• CDS coordinates: 87-527 (+)
• Peptide sequence: MQTSFSWLNIYPEGIEKAVTYVKDRYNNTPMFITENGYGEQDNPNLTMAEQLHDFRRIKCMTDYMEALSKAVRKGADVRGYLAWSLLDNFEWIYGYTIRYGLHHVDYATQKRTPRLSATWYKQLIANHKGASLSRMIGQQKGVHTT*
• ORF Type: complete

Annotations of Ll_transcript_452822

• Blastp: Beta-glucosidase 46 from Arabidopsis with 55.28% of identity
• Blastx: Beta-glucosidase 46 from Arabidopsis with 55.28% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (AT1G61820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450630.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;