Protein coding transcript 155671

• Transcript: Ll_transcript_229640
• CDS coordinates: 2518-3219 (+)
• Peptide sequence: MASICLVTIGDGVWASGVLLNSQGLILTNAHLLEPWRFGKTHLSGGGYGTNSEKFPFKLEGATDLRNGIASIQKSQTLPSKVGTVYSFTADTYNNYRNIRVRLDHVNPSVWCGARVVYICKGPWDVALLQLESVPEKLLPVEINFSRPSTGSKTHVIGHGLFGPKCGFFPSVCSGVVAKVVEAKTPQSYQSIQPELKYMHEFFPAMLETTAAVHPGASGGAVINSDGHMIGLVT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_229640

• Blastp: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 56.5% of identity
• Blastx: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 50.94% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT1G28320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419712.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;