Protein coding transcript 155677

• Transcript: Ll_transcript_229646
• CDS coordinates: 2264-3322 (+)
• Peptide sequence: MASICLVTIGDGVWASGVLLNSQGLILTNAHLLEPWRFGKTHLSGGGYGTNSEKFPFKLEGATDLRNGIASIQKSQTLPSKVGTVYSFTADTYNNYRNIRVRLDHVNPSVWCGARVVYICKGPWDVALLQLESVPEKLLPVEINFSRPSTGSKTHVIGHGLFGPKCGFFPSVCSGVVAKVVEAKTPQSYQSIQPELKYMHEFFPAMLETTAAVHPGASGGAVINSDGHMIGLVTSNARHGGGTIIPHLNFSIPSAALLPVFKFSKDMKNFSLLRILDEPDEYISSVWALMRPSSPKVNGMPNLPQSLVDNKSKDVKGSQFAKFIAERNDIFKMPSNIGKSGVLTKEAFLSKL*
• ORF Type: complete

Annotations of Ll_transcript_229646

• Blastp: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 56.15% of identity
• Blastx: Glyoxysomal processing protease, glyoxysomal from Arabidopsis with 53.41% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT1G28320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419712.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;