Protein coding transcript 155688

• Transcript: Ll_transcript_228133
• CDS coordinates: 204-680 (+)
• Peptide sequence: MLEAAEEPEFLMADMSPEQLSSFSAYKAKLNAIKHSEMEKTIEKALKDAGLRNREVTPFMRLRVVGLTHKTRQDRPKEGIVTIWNPTEKQRQELVEGEAYVIAGLIPSGVDLDILHLQTRGSSTQWLPLSSDAKEQFNLLLSFAGLFSVIENRSQCQA*
• ORF Type: complete

Annotations of Ll_transcript_228133

• Blastp: Protein BREAST CANCER SUSCEPTIBILITY 2 homolog B from Arabidopsis with 56.83% of identity
• Blastx: Protein BREAST CANCER SUSCEPTIBILITY 2 homolog B from Arabidopsis with 45.48% of identity
• Eggnog: Breast cancer 2, early onset(ENOG410Y06W)
• Kegg: Link to kegg annotations (AT5G01630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438736.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;