| Transcript | Ll_transcript_452797 |
|---|---|
| CDS coordinates | 31-816 (+) |
| Peptide sequence | MMQLPQSLALSLFIILPSIFYGYVEANQVTFYVHNKCTFPIWPATAPNNGQPIIADGGFYLGSGQTKQIVAPWLWSGRIWGRTGCNFASNLKPACETGDCDGRLSCNGLIGTPPATLLEITLQGDKTKPNFYDISLVDGYNIPISITPKTRNPNCNIQGCFKDLKSCCPNELEVLNNKGEVVACKSACLAFNMDRFCCRNEYGTPQKCKPNVYSNIFKDVCPNYYSYAFDTPSPLVSCVSSEYVVTFCPSGFGGIEENESE* |
| ORF Type | complete |
| Blastp | Thaumatin-like protein from Arabidopsis with 49.56% of identity |
|---|---|
| Blastx | Thaumatin-like protein from Arabidopsis with 49.56% of identity |
| Eggnog | thaumatin-like protein(ENOG4111KEV) |
| Kegg | Link to kegg annotations (AT1G18250) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452931.1) |
| Pfam | Thaumatin family (PF00314.16) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer