Transcript | Ll_transcript_228864 |
---|---|
CDS coordinates | 244-627 (+) |
Peptide sequence | MPPIFSPFYIIPITLLLPNKHPKPPFSLHIKALSPLQNLLQKTQPLSPPKVQSFFTLSLILQILKMTTFEKEDLGLSLSLSFSHHPSNPLHFNLVSSPYSSSPSGCNPHKPSWINDPFTSSGVYCII* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Homeobox-leucine zipper protein HAT4 from Arabidopsis with 84.42% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423779.1) |
Pfam | HD-ZIP protein N terminus (PF04618.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer