Transcript | Ll_transcript_227844 |
---|---|
CDS coordinates | 1281-1964 (-) |
Peptide sequence | MAFNNKTCSDLLLGMSPCVVTIKTEYSSSSSSSSSNNDVCFHLSMGVCPCSHAYDSSSKGMSTCDTTRSLTPCSSSTNKRKHDQKDDSIRQRKKACNDRERIRWGYSLDLMLYDDPWKIKKVLQKSDIGNMSRLLLPKDLAENLVLPVLNADARRDAETERGTKLWIWDVDTNSMHSLLFKRWGSSKSYVFIDKWVQDFVKRRDLKAEDEVAFHWDPYNHHFAFTVL* |
ORF Type | complete |
Blastp | B3 domain-containing protein At2g33720 from Arabidopsis with 32.59% of identity |
---|---|
Blastx | B3 domain-containing protein At2g33720 from Arabidopsis with 32.59% of identity |
Eggnog | Transcription factor(ENOG4111D7C) |
Kegg | Link to kegg annotations (AT2G33720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421579.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer