Protein coding transcript 155784

• Transcript: Ll_transcript_227838
• CDS coordinates: 3-758 (-)
• Peptide sequence: MKNAIGTMLVEERNAYHRKKLAAILNSDPTSLYTQNHYDDHDFSNQRHSIATATPTGSSNNTSPLIMSPWNQDSSSPYNNSPWSSTASVINHFDDNSDSNRKNSESVLIGSLDREEGHIYSLAVLRDLLYTGSDSKNIRVWKHMKDYTGFKSSSGLIKTIVISGEKIFTGHRDGKIRVWKASNKNPRSYKRVGSMPRFKDYVKSSMNPKNYVEVRPHRTAVKVKHIDAISSLSLDEEEGLLYSGSWDKTLKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_227838

• Blastp: Protein JINGUBANG from Arabidopsis with 51.6% of identity
• Blastx: Protein JINGUBANG from Arabidopsis with 50.8% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT2G26490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449759.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;