Protein coding transcript 155818

• Transcript: Ll_transcript_229550
• CDS coordinates: 523-1782 (+)
• Peptide sequence: MEEVFEKIEVDGSMCCDEIDFEYEFDAPRFCDFMTPETFLDAFEAEQWFDYATSYPPSPFLLKFNLGNAGAMESENDIADDEEVSAIDDNSSTVEDTLDGKMKPFSKLTQSVSKISRFMKPTASHLAKQKNPTEVLSTHSHRRFPSQNSSIDIQLTKRQKLEAGYLSKVARLKHQTLFRHKKLKEVDLADNNVVSKSKVTIPKEPNLETASRAQRNRSKANAEPGGDTKSSSKTIKARPVNKKILEASPQPSHKKKTPRLTEFNVFHLRTSERAMQHTSSSAGGVLNSNSVSNSETRDLKRTNSSDRSMQEKCRVVNKLRGSPDKVLSSKGERGVFRNIKVFPLLSLASDVKQTTKLQSKKQPVSKGLKENRPGSLHQEHEKMNMIKEGIQILCRKQHKCTNEMGSLISKHTPIPELGH*
• ORF Type: complete

Annotations of Ll_transcript_229550

• Blastp: Protein TPX2 from Arabidopsis with 33.75% of identity
• Blastx: Protein TPX2 from Arabidopsis with 33.75% of identity
• Eggnog: Cell cycle regulated microtubule associated protein(ENOG410ZTMD)
• Kegg: Link to kegg annotations (AT1G03780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451543.1)
• Pfam: Cell cycle regulated microtubule associated protein (PF12214.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;