Transcript | Ll_transcript_228170 |
---|---|
CDS coordinates | 112-801 (+) |
Peptide sequence | MEDERWKEAIGSSSTSGVGEIPETLNEATFHEEDEEETEEEDEEHIGDHKNATFVPGPLLSLKEQIERDKEDESLRRWKEKLLGCLESDLNGQMDPEVKFHSIGIISDDHGEVVTPLPVDENKKDHVLFTLKEGCHYHLTLKFSVLHNIVSGLAYSNTVWKGGIRVDQTRGMLGTFAPQKEPYIHALKEDVAPSGALARGVYSAKLKFEDDDKRCHMELKYSFEIKKRK* |
ORF Type | complete |
Blastp | Rho GDP-dissociation inhibitor 1 from Arabidopsis with 51.16% of identity |
---|---|
Blastx | Rho GDP-dissociation inhibitor 1 from Arabidopsis with 51.16% of identity |
Eggnog | Rho GDP dissociation inhibitor (GDI)(ENOG4111K44) |
Kegg | Link to kegg annotations (AT3G07880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433056.1) |
Pfam | RHO protein GDP dissociation inhibitor (PF02115.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer